SCOPe 2.08: Domain d6eh8a1: 6eh8 A:1-115

Lineage for d6eh8a1 (6eh8 A:1-115)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)

8. Domain d6eh8a1: 6eh8 A:1-115 [351171]
   Other proteins in same PDB: d6eh8a2, d6eh8b1, d6eh8b2
   automated match to d1j8hd1

Details for d6eh8a1

PDB Entry: 6eh8, 2.51 Å

PDB Description: ha1.7 human t-cell receptor specific for influenza virus epitope pkyvkqntlklat presented by human leukocyte antigen hla-dr0101

PDB Compounds: (A:) Human T Cell Receptor Alpha Chain

SCOPe Domain Sequences for d6eh8a1:

Sequence; same for both SEQRES and ATOM records:

>d6eh8a1 b.1.1.1 (A:1-115) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsvtqlgshvsvsegalvllrcnysssvppylfwyvqypnqglqlllkytsaatlvkgin
gfeaefkksetsfhltkpsahmsdaaeyfcavsespfgnekltfgtgtrltiipn

Timeline for d6eh8a1:

• d6eh8a1 first appeared in SCOPe 2.07