SCOPe 2.08: Domain d6eh4d2: 6eh4 D:113-205

Lineage for d6eh4d2 (6eh4 D:113-205)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d6eh4d2: 6eh4 D:113-205 [351170]
   Other proteins in same PDB: d6eh4d1, d6eh4e1, d6eh4e2
   automated match to d2pyfa2
   complexed with edo, gol

Details for d6eh4d2

PDB Entry: 6eh4, 1.26 Å

PDB Description: 003 human t-cell receptor specific for hiv gag epitope slyntvatl carried by human leukocyte antigen hla-a*0201

PDB Compounds: (D:) Human T Cell Receptor Alpha Chain

SCOPe Domain Sequences for d6eh4d2:

Sequence; same for both SEQRES and ATOM records:

>d6eh4d2 b.1.1.2 (D:113-205) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpspess

Timeline for d6eh4d2:

• d6eh4d2 first appeared in SCOPe 2.07