SCOPe 2.08: Domain d6cmic1: 6cmi C:1-106

Lineage for d6cmic1 (6cmi C:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6cmic1: 6cmi C:1-106 [351167]
   Other proteins in same PDB: d6cmic2
   automated match to d4oawa1
   complexed with nag

Details for d6cmic1

PDB Entry: 6cmi, 2.72 Å

PDB Description: crystal structure of the hendra virus attachment g glycoprotein bound to a potent cross-reactive neutralizing human monoclonal antibody m102.3

PDB Compounds: (C:) m102.3 light chain

SCOPe Domain Sequences for d6cmic1:

Sequence; same for both SEQRES and ATOM records:

>d6cmic1 b.1.1.0 (C:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivmtqspgtpslspgeratlscrasqsirstylawyqqkpgqaprlliygassratgip
drfsgsgsgtdftltisrlepedfavyycqqygrspsfgqgtkvei

Timeline for d6cmic1:

• d6cmic1 first appeared in SCOPe 2.07