Lineage for d6ehsm_ (6ehs M:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2624340Fold e.18: HydB/Nqo4-like [56761] (1 superfamily)
    3 domains: (1) all-alpha; (2&3) alpha+beta
  4. 2624341Superfamily e.18.1: HydB/Nqo4-like [56762] (3 families) (S)
  5. 2624506Family e.18.1.0: automated matches [191637] (1 protein)
    not a true family
  6. 2624507Protein automated matches [191173] (15 species)
    not a true protein
  7. 2624580Species Escherichia coli [TaxId:83334] [351162] (1 PDB entry)
  8. 2624582Domain d6ehsm_: 6ehs M: [351163]
    Other proteins in same PDB: d6ehss_, d6ehst_
    automated match to d3myrd_
    complexed with dtn, f3s, fco, mg, ni, sf4

Details for d6ehsm_

PDB Entry: 6ehs (more details), 1.5 Å

PDB Description: e. coli hydrogenase-2 chemically reduced structure
PDB Compounds: (M:) Hydrogenase-2 large chain

SCOPe Domain Sequences for d6ehsm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ehsm_ e.18.1.0 (M:) automated matches {Escherichia coli [TaxId: 83334]}
sqritidpvtrieghlridceiengvvskawasgtmwrgmeeivknrdprdawmivqric
gvcttthalssvraaesalnidvpvnaqyirniilaahtthdhivhfyqlsaldwvdits
alqadptkasemlkgvstwhlnspeeftkvqnkikdlvasgqlgifangywghpamklpp
evnliavahylqalecqrdanrvvallggktphiqnlavggvanpinldglgvlnlerlm
yiksfidklsdfveqvykvdtaviaafypewltrgkgavnylsvpefptdskngsflfpg
gyienadlssyrpitshsdeylikgiqesakhswykdeapqapwegttipaydgwsddgk
yswvksptfygktvevgplanmlvklaagrestqnklneivaiyqkltgntlevaqlhst
lgriigrtvhccelqdilqnqysalitnigkgdhttfvkpnipatgefkgvgfleaprgm
lshwmvikdgiisnyqavvpstwnsgprnfnddvgpyeqslvgtpvadpnkplevvrtih
sfdpcmacavh

SCOPe Domain Coordinates for d6ehsm_:

Click to download the PDB-style file with coordinates for d6ehsm_.
(The format of our PDB-style files is described here.)

Timeline for d6ehsm_: