Lineage for d5at1a1 (5at1 A:1-150)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2156150Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2156151Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2156152Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)
  6. 2156153Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species)
  7. 2156161Species Escherichia coli [TaxId:562] [53674] (63 PDB entries)
    Uniprot P00479
  8. 2156250Domain d5at1a1: 5at1 A:1-150 [35116]
    Other proteins in same PDB: d5at1b1, d5at1b2, d5at1d1, d5at1d2
    complexed with ctp, zn

Details for d5at1a1

PDB Entry: 5at1 (more details), 2.6 Å

PDB Description: structural consequences of effector binding to the t state of aspartate carbamoyltransferase. crystal structures of the unligated and atp-, and ctp-complexed enzymes at 2.6-angstroms resolution
PDB Compounds: (A:) aspartate carbamoyltransferase (t state), catalytic chain

SCOPe Domain Sequences for d5at1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5at1a1 c.78.1.1 (A:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfq
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqqteg

SCOPe Domain Coordinates for d5at1a1:

Click to download the PDB-style file with coordinates for d5at1a1.
(The format of our PDB-style files is described here.)

Timeline for d5at1a1: