Lineage for d6cy6a_ (6cy6 A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. Protein automated matches [190038] (49 species)
    not a true protein
  7. Species Escherichia coli [TaxId:83333] [260781] (4 PDB entries)
  8. Domain d6cy6a_: 6cy6 A: [351153]
    automated match to d4r9ma_
    complexed with cl, mpd, mrd, na, trs

Details for d6cy6a_

PDB Entry: 6cy6 (more details), 1.7500000000000002 Å

PDB Description: crystal structure of spermidine/spermine n-acetyltransferase speg from escherichia coli in complex with tris(hydroxymethyl)aminomethane.
PDB Compounds: (A:) Spermidine N(1)-acetyltransferase

SCOPe Domain Sequences for d6cy6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cy6a_ d.108.1.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
hsvklrpleredlryvhqldnnasvmrywfeepyeafvelsdlydkhihdqserrfvvec
dgekaglvelveinhvhrraefqiiispeyqgkglatraaklamdygftvlnlyklyliv
dkenekaihiyrklgfsvegelmheffingqyrnairmcifqhqylaeh

SCOPe Domain Coordinates for d6cy6a_ are not available.

Timeline for d6cy6a_: