SCOPe 2.08: Domain d6cmgb2: 6cmg B:107-213

Lineage for d6cmgb2 (6cmg B:107-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d6cmgb2: 6cmg B:107-213 [351151]
   Other proteins in same PDB: d6cmgb1, d6cmgc_
   automated match to d4oawa2
   complexed with nag

Details for d6cmgb2

PDB Entry: 6cmg, 2.7 Å

PDB Description: crystal structure of the hendra virus attachment g glycoprotein bound to a potent cross-reactive neutralizing human monoclonal antibody m102.3

PDB Compounds: (B:) m102.3 light chain

SCOPe Domain Sequences for d6cmgb2:

Sequence, based on SEQRES records:

>d6cmgb2 b.1.1.2 (B:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhklyacevthqglsspvtksfnrge

Sequence, based on observed residues (ATOM records):

>d6cmgb2 b.1.1.2 (B:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdsty
slsstltlskadyekhklyacevthqglsspvtksfnrge

Timeline for d6cmgb2:

• d6cmgb2 first appeared in SCOPe 2.07