Lineage for d6cmgb2 (6cmg B:107-213)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (17 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)
  8. 3051089Domain d6cmgb2: 6cmg B:107-213 [351151]
    Other proteins in same PDB: d6cmgb1
    automated match to d4oawa2
    complexed with bma, fuc, man, nag

Details for d6cmgb2

PDB Entry: 6cmg (more details), 2.7 Å

PDB Description: crystal structure of the hendra virus attachment g glycoprotein bound to a potent cross-reactive neutralizing human monoclonal antibody m102.3
PDB Compounds: (B:) m102.3 light chain

SCOPe Domain Sequences for d6cmgb2:

Sequence, based on SEQRES records: (download)

>d6cmgb2 b.1.1.2 (B:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhklyacevthqglsspvtksfnrge

Sequence, based on observed residues (ATOM records): (download)

>d6cmgb2 b.1.1.2 (B:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdsty
slsstltlskadyekhklyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d6cmgb2:

Click to download the PDB-style file with coordinates for d6cmgb2.
(The format of our PDB-style files is described here.)

Timeline for d6cmgb2:

  • d6cmgb2 is new in SCOPe 2.07-stable