SCOPe 2.07: Domain d6cx8e1: 6cx8 E:1-173

Lineage for d6cx8e1 (6cx8 E:1-173)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (48 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:666] [188612] (22 PDB entries)

8. Domain d6cx8e1: 6cx8 E:1-173 [351146]
   Other proteins in same PDB: d6cx8e2
   automated match to d4mhdc_
   complexed with ipa, mn, mpd, po4

Details for d6cx8e1

PDB Entry: 6cx8, 2.41 Å

PDB Description: crystal structure of spermidine/spermine n-acetyltransferase speg from vibrio cholerae in complex with manganese ions.

PDB Compounds: (E:) Spermidine N(1)-acetyltransferase

SCOPe Domain Sequences for d6cx8e1:

Sequence, based on SEQRES records:

>d6cx8e1 d.108.1.0 (E:1-173) automated matches {Vibrio cholerae [TaxId: 666]}
mnsqltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerrfvv
edaqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiy
lhvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnrse

Sequence, based on observed residues (ATOM records):

>d6cx8e1 d.108.1.0 (E:1-173) automated matches {Vibrio cholerae [TaxId: 666]}
mnsqltlralergdlrfihnlnnmsywfeepyesfdeleelynkhihdnaerrfvvedaq
knliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiylhva
venpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnrse

Timeline for d6cx8e1:

• d6cx8e1 is new in SCOPe 2.07-stable
  
• d6cx8e1 appears in the current release, SCOPe 2.08