Class b: All beta proteins [48724] (180 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.5: Actin-crosslinking proteins [50405] (3 families) |
Family b.42.5.0: automated matches [267627] (1 protein) not a true family |
Protein automated matches [267678] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [267866] (2 PDB entries) |
Domain d6b0te4: 6b0t E:383-493 [351133] automated match to d3llpa4 complexed with c7v |
PDB Entry: 6b0t (more details), 2.8 Å
SCOPe Domain Sequences for d6b0te4:
Sequence; same for both SEQRES and ATOM records: (download)
>d6b0te4 b.42.5.0 (E:383-493) automated matches {Human (Homo sapiens) [TaxId: 9606]} rpiivfrgehgfigcrkvtgtldanrssydvfqlefndgaynikdstgkywtvgsdsavt ssgdtpvdfffefcdynkvaikvggrylkgdhagvlkasaetvdpaslwey
Timeline for d6b0te4: