Lineage for d6at1a2 (6at1 A:151-310)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)
  6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species)
  7. Species Escherichia coli [TaxId:562] [53674] (62 PDB entries)
    Uniprot P00479
  8. Domain d6at1a2: 6at1 A:151-310 [35113]
    Other proteins in same PDB: d6at1b1, d6at1b2, d6at1d1, d6at1d2
    complexed with zn

Details for d6at1a2

PDB Entry: 6at1 (more details), 2.6 Å

PDB Description: structural consequences of effector binding to the t state of aspartate carbamoyltransferase. crystal structures of the unligated and atp-, and ctp-complexed enzymes at 2.6-angstroms resolution
PDB Compounds: (A:) aspartate carbamoyltransferase (t state), catalytic chain

SCOPe Domain Sequences for d6at1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6at1a2 c.78.1.1 (A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
rldnlhvamvgdlkygrtvhsltqalakfdgnrfyfiapdalampeyildmldekgiaws
lhssieevmaevdilymtrvqkerldpseyanvkaqfvlrasdlhnakanmkvlhplprv
deiatdvdktphawyfqqagngifarqallalvlnrdlvl

SCOPe Domain Coordinates for d6at1a2 are not available.

Timeline for d6at1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6at1a1
View in 3D
Domains from other chains:
(mouse over for more information)
d6at1b1, d6at1b2, d6at1c1, d6at1c2, d6at1d1, d6at1d2