Lineage for d5vjqd2 (5vjq D:108-213)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752590Domain d5vjqd2: 5vjq D:108-213 [351102]
    Other proteins in same PDB: d5vjqa_, d5vjqb1, d5vjqc_, d5vjqd1, d5vjqe_, d5vjqf1, d5vjqg_, d5vjqh1, d5vjqi_, d5vjqj_, d5vjqk_, d5vjql_
    automated match to d2fd6l2
    complexed with cl, gol; mutant

Details for d5vjqd2

PDB Entry: 5vjq (more details), 1.9 Å

PDB Description: complex between hyhel10 fab fragment heavy chain mutant (i29f, s52t, y53f) and pekin duck egg lysozyme isoform i (del-i)
PDB Compounds: (D:) HyHEL10 light chain Fab fragment

SCOPe Domain Sequences for d5vjqd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vjqd2 b.1.1.2 (D:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d5vjqd2:

Click to download the PDB-style file with coordinates for d5vjqd2.
(The format of our PDB-style files is described here.)

Timeline for d5vjqd2: