SCOP 1.57: Domain d4at1c1: 4at1 C:1-150

Lineage for d4at1c1 (4at1 C:1-150)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (2 proteins)

6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (2 species)

7. Species Escherichia coli [TaxId:562] [53674] (28 PDB entries)

8. Domain d4at1c1: 4at1 C:1-150 [35110]
   Other proteins in same PDB: d4at1b1, d4at1b2, d4at1d1, d4at1d2

Details for d4at1c1

PDB Entry: 4at1, 2.6 Å

PDB Description: structural consequences of effector binding to the t state of aspartate carbamoyltransferase. crystal structures of the unligated and atp-, and ctp-complexed enzymes at 2.6-angstroms resolution

SCOP Domain Sequences for d4at1c1:

Sequence; same for both SEQRES and ATOM records:

>d4at1c1 c.78.1.1 (C:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfq
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqqteg

Timeline for d4at1c1:

• d4at1c1 first appeared (with stable ids) in SCOP 1.55
  
• d4at1c1 appears in SCOP 1.59
  
• d4at1c1 appears in the current release, SCOPe 2.08