SCOPe 2.07: Domain d6ep6a2: 6ep6 A:84-215

Lineage for d6ep6a2 (6ep6 A:84-215)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (71 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [324612] (22 PDB entries)

8. Domain d6ep6a2: 6ep6 A:84-215 [351094]
   Other proteins in same PDB: d6ep6a1, d6ep6b1
   automated match to d5g5aa2
   complexed with gol, mg

Details for d6ep6a2

PDB Entry: 6ep6, 1.59 Å

PDB Description: arabidopsis thaliana gstu23, reduced

PDB Compounds: (A:) Glutathione S-transferase U23

SCOPe Domain Sequences for d6ep6a2:

Sequence; same for both SEQRES and ATOM records:

>d6ep6a2 a.45.1.0 (A:84-215) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ilpsdpyqraqarfwadyidkktyvpckalwsesgekqeaakiefievlktldselgdky
yfggnefglvdiafigfyswfrtyeevanlsivlefpklmawaqrclkresvakalpdsd
kvlksvsdhrki

Timeline for d6ep6a2:

• d6ep6a2 is new in SCOPe 2.07-stable
  
• d6ep6a2 appears in the current release, SCOPe 2.08