Lineage for d6ep6a2 (6ep6 A:84-215)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2714244Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [324612] (22 PDB entries)
  8. 2714245Domain d6ep6a2: 6ep6 A:84-215 [351094]
    Other proteins in same PDB: d6ep6a1, d6ep6b1
    automated match to d5g5aa2
    complexed with gol, mg

Details for d6ep6a2

PDB Entry: 6ep6 (more details), 1.59 Å

PDB Description: arabidopsis thaliana gstu23, reduced
PDB Compounds: (A:) Glutathione S-transferase U23

SCOPe Domain Sequences for d6ep6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ep6a2 a.45.1.0 (A:84-215) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ilpsdpyqraqarfwadyidkktyvpckalwsesgekqeaakiefievlktldselgdky
yfggnefglvdiafigfyswfrtyeevanlsivlefpklmawaqrclkresvakalpdsd
kvlksvsdhrki

SCOPe Domain Coordinates for d6ep6a2:

Click to download the PDB-style file with coordinates for d6ep6a2.
(The format of our PDB-style files is described here.)

Timeline for d6ep6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ep6a1