Lineage for d4at1a2 (4at1 A:151-310)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 320535Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 320536Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family) (S)
  5. 320537Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins)
  6. 320538Protein Aspartate carbamoyltransferase catalytic subunit [53673] (3 species)
  7. 320549Species Escherichia coli [TaxId:562] [53674] (29 PDB entries)
  8. 320577Domain d4at1a2: 4at1 A:151-310 [35109]
    Other proteins in same PDB: d4at1b1, d4at1b2, d4at1d1, d4at1d2

Details for d4at1a2

PDB Entry: 4at1 (more details), 2.6 Å

PDB Description: structural consequences of effector binding to the t state of aspartate carbamoyltransferase. crystal structures of the unligated and atp-, and ctp-complexed enzymes at 2.6-angstroms resolution
PDB Compounds: (A:)

SCOP Domain Sequences for d4at1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4at1a2 c.78.1.1 (A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli}
rldnlhvamvgdlkygrtvhsltqalakfdgnrfyfiapdalampeyildmldekgiaws
lhssieevmaevdilymtrvqkerldpseyanvkaqfvlrasdlhnakanmkvlhplprv
deiatdvdktphawyfqqagngifarqallalvlnrdlvl

SCOP Domain Coordinates for d4at1a2:

Click to download the PDB-style file with coordinates for d4at1a2.
(The format of our PDB-style files is described here.)

Timeline for d4at1a2: