Lineage for d5y5sm_ (5y5s M:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2632594Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 2632595Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 2632596Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 2632815Protein automated matches [190224] (14 species)
    not a true protein
  7. 2632918Species Thermochromatium tepidum [TaxId:1050] [267912] (5 PDB entries)
  8. 2632919Domain d5y5sm_: 5y5s M: [351084]
    Other proteins in same PDB: d5y5s0_, d5y5s1_, d5y5s2_, d5y5s3_, d5y5s4_, d5y5s5_, d5y5s6_, d5y5s7_, d5y5s8_, d5y5s9_, d5y5sa_, d5y5sb_, d5y5sc_, d5y5sd_, d5y5se_, d5y5sf_, d5y5sg_, d5y5sh1, d5y5sh2, d5y5si_, d5y5sj_, d5y5sk_, d5y5sn_, d5y5so_, d5y5sp_, d5y5sq_, d5y5sr_, d5y5ss_, d5y5st_, d5y5su_, d5y5sv_, d5y5sw_, d5y5sx_, d5y5sy_, d5y5sz_
    automated match to d3wmmm_
    complexed with bcl, bph, ca, cdl, crt, fe, gol, hem, lda, lhg, lmt, mg, mq8, pef, pgv, so4, unl, uq8

Details for d5y5sm_

PDB Entry: 5y5s (more details), 1.9 Å

PDB Description: structure of photosynthetic lh1-rc super-complex at 1.9 angstrom resolution
PDB Compounds: (M:) Photosynthetic reaction center M subunit

SCOPe Domain Sequences for d5y5sm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y5sm_ f.26.1.1 (M:) automated matches {Thermochromatium tepidum [TaxId: 1050]}
peyqniftavqvrapaypgvplpkgnlprigrpifsywlgkigdaqigpiylgltgtlsi
ffglvaisiigfnmlasvhwdvfqflkhffwlgleppppqyglripplseggwwlmaglf
ltlsillwwvrtykraealgmsqhlswafaaaiffylvlgfirpvmmgswakavpfgifp
hldwtaafsirygnlyynpfhmlsiaflygsallfamhgatilsvsrfggdreidqithr
gtaaeraalfwrwtmgfnvtmesihrwawwcavltvitagigillsgtvvdnwylwavkh
gmapaypevvtavnpyet

SCOPe Domain Coordinates for d5y5sm_:

Click to download the PDB-style file with coordinates for d5y5sm_.
(The format of our PDB-style files is described here.)

Timeline for d5y5sm_: