Lineage for d5vjea_ (5vje A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835398Family c.1.10.2: Class II FBP aldolase [51591] (3 proteins)
    metal-dependent
    automatically mapped to Pfam PF01116
  6. 2835399Protein Fructose-bisphosphate aldolase (FBP aldolase) [51592] (3 species)
  7. 2835407Species Escherichia coli [TaxId:83333] [336437] (8 PDB entries)
  8. 2835408Domain d5vjea_: 5vje A: [351077]
    automated match to d1gyna_
    complexed with gos, na

Details for d5vjea_

PDB Entry: 5vje (more details), 1.65 Å

PDB Description: class ii fructose-1,6-bisphosphate aldolase of escherichia coli with d-glucitol 1,6-bisphosphate
PDB Compounds: (A:) Fructose-bisphosphate aldolase class 2

SCOPe Domain Sequences for d5vjea_:

Sequence, based on SEQRES records: (download)

>d5vjea_ c.1.10.2 (A:) Fructose-bisphosphate aldolase (FBP aldolase) {Escherichia coli [TaxId: 83333]}
skifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivqf
snggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwid
glldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgctgg
eedgvdnshmdasalytqpedvdyaytelskisprftiaasfgnvhgvykpgnvvltpti
lrdsqeyvskkhnlphnslnfvfhggsgstaqeikdsvsygvvkmnidtdtqwatwegvl
nyykaneaylqgqlgnpkgedqpnkkyydprvwlragqtsmiarlekafqelnaidvl

Sequence, based on observed residues (ATOM records): (download)

>d5vjea_ c.1.10.2 (A:) Fructose-bisphosphate aldolase (FBP aldolase) {Escherichia coli [TaxId: 83333]}
skifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivqf
snggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwid
glldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgytqp
edvdyaytelskisprftiaasfgnvhgvykpgnvvltptilrdsqeyvskkhnlphnsl
nfvfhggsgstaqeikdsvsygvvkmnidtdtqwatwegvlnyykaneaylqgqlgnpkg
edqpnkkyydprvwlragqtsmiarlekafqelnaidvl

SCOPe Domain Coordinates for d5vjea_:

Click to download the PDB-style file with coordinates for d5vjea_.
(The format of our PDB-style files is described here.)

Timeline for d5vjea_: