![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
![]() | Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
![]() | Protein automated matches [226837] (7 species) not a true protein |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [278810] (10 PDB entries) |
![]() | Domain d5yljc1: 5ylj C:1-245 [351074] Other proteins in same PDB: d5ylja2, d5yljb2, d5yljc2, d5yljd2, d5ylje_, d5yljf1, d5yljf2, d5yljf3 automated match to d5fnva1 complexed with 8x0, acp, ca, gdp, gol, gtp, mes, mg |
PDB Entry: 5ylj (more details), 2.7 Å
SCOPe Domain Sequences for d5yljc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5yljc1 c.32.1.1 (C:1-245) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita slrfd
Timeline for d5yljc1: