Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily) membrane all-alpha fold |
Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families) |
Family f.3.1.0: automated matches [254203] (1 protein) not a true family |
Protein automated matches [254444] (10 species) not a true protein |
Species Thermochromatium tepidum [TaxId:1050] [267909] (5 PDB entries) |
Domain d5y5sv_: 5y5s V: [351073] Other proteins in same PDB: d5y5sc_, d5y5sh1, d5y5sh2, d5y5sm_ automated match to d1wrga_ complexed with bcl, bph, ca, cdl, crt, fe, gol, hec, lda, lhg, lmt, mg, mq8, pef, pgv, so4, unl, uq8 |
PDB Entry: 5y5s (more details), 1.9 Å
SCOPe Domain Sequences for d5y5sv_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5y5sv_ f.3.1.0 (V:) automated matches {Thermochromatium tepidum [TaxId: 1050]} sltgltddeakefhaifmqsmyawfglvviahllawlyrpwl
Timeline for d5y5sv_:
View in 3D Domains from other chains: (mouse over for more information) d5y5s0_, d5y5s1_, d5y5s2_, d5y5s3_, d5y5s4_, d5y5s5_, d5y5s6_, d5y5s7_, d5y5s8_, d5y5s9_, d5y5sa_, d5y5sb_, d5y5sc_, d5y5sd_, d5y5se_, d5y5sf_, d5y5sg_, d5y5sh1, d5y5sh2, d5y5si_, d5y5sj_, d5y5sk_, d5y5sm_, d5y5sn_, d5y5so_, d5y5sp_, d5y5sq_, d5y5sr_, d5y5ss_, d5y5st_, d5y5su_, d5y5sw_, d5y5sx_, d5y5sy_, d5y5sz_ |