Lineage for d5ossb_ (5oss B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2440113Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 proteins)
  6. 2440123Protein Beta-glucosidase A [51528] (10 species)
  7. 2440191Species Thermotoga maritima [TaxId:243274] [351022] (1 PDB entry)
  8. 2440193Domain d5ossb_: 5oss B: [351069]
    automated match to d1oifa_
    complexed with aez, cl, edo, na

Details for d5ossb_

PDB Entry: 5oss (more details), 1.7 Å

PDB Description: beta-glucosidase from thermotoga maritima in complex with gluco-1h- imidazole
PDB Compounds: (B:) beta-glucosidase a

SCOPe Domain Sequences for d5ossb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ossb_ c.1.8.4 (B:) Beta-glucosidase A {Thermotoga maritima [TaxId: 243274]}
vkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrwk
edieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtiyhw
dlpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghlygvhap
gmrdiyvafravhnllraharavkvfretvkdgkigivfnngyfepasekeediravrfm
hqfnnyplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysghlvkf
dpdapakvsfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddvvse
dgrvhdqnridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyvdys
tqkrivkdsgywysnvvknngle

SCOPe Domain Coordinates for d5ossb_:

Click to download the PDB-style file with coordinates for d5ossb_.
(The format of our PDB-style files is described here.)

Timeline for d5ossb_: