Lineage for d5vffa_ (5vff A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2382505Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2382506Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 2382667Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
    topologically similar to the C-terminal domain of PapD
  6. 2382693Protein Synaptogamin I [49576] (3 species)
    duplication: contains tandem repeat of two similar domains
  7. 2382714Species Mouse (Mus musculus) [TaxId:10090] [335436] (5 PDB entries)
  8. 2382717Domain d5vffa_: 5vff A: [351067]
    automated match to d5w5df_
    complexed with pb

Details for d5vffa_

PDB Entry: 5vff (more details), 1.41 Å

PDB Description: synaptotagmin 1 c2b domain, lead-bound (low occupancy)
PDB Compounds: (A:) Synaptotagmin-1

SCOPe Domain Sequences for d5vffa_:

Sequence, based on SEQRES records: (download)

>d5vffa_ b.7.1.2 (A:) Synaptogamin I {Mouse (Mus musculus) [TaxId: 10090]}
eklgdisfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkrlkkkktti
kkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgynstgaelrhw
sdmlanprrpiaqwhtlqveeevdamlavkk

Sequence, based on observed residues (ATOM records): (download)

>d5vffa_ b.7.1.2 (A:) Synaptogamin I {Mouse (Mus musculus) [TaxId: 10090]}
eklgdisfslryvptagkltvvileaknlkkmdvlsdpyvkihlmqngkrlkkkkttikk
ntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgynstgaelrhwsd
mlanprrpiaqwhtlqveeevdamlavkk

SCOPe Domain Coordinates for d5vffa_:

Click to download the PDB-style file with coordinates for d5vffa_.
(The format of our PDB-style files is described here.)

Timeline for d5vffa_: