Lineage for d5y5sh2 (5y5s H:44-259)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2401018Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 2401019Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 2401020Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)
  6. 2401149Protein automated matches [226918] (3 species)
    not a true protein
  7. 2401164Species Thermochromatium tepidum [TaxId:1050] [267913] (5 PDB entries)
  8. 2401165Domain d5y5sh2: 5y5s H:44-259 [351064]
    Other proteins in same PDB: d5y5s0_, d5y5s1_, d5y5s2_, d5y5s3_, d5y5s4_, d5y5s5_, d5y5s6_, d5y5s7_, d5y5s8_, d5y5s9_, d5y5sa_, d5y5sb_, d5y5sc_, d5y5sd_, d5y5se_, d5y5sf_, d5y5sg_, d5y5sh1, d5y5si_, d5y5sj_, d5y5sk_, d5y5sm_, d5y5sn_, d5y5so_, d5y5sp_, d5y5sq_, d5y5sr_, d5y5ss_, d5y5st_, d5y5su_, d5y5sv_, d5y5sw_, d5y5sx_, d5y5sy_, d5y5sz_
    automated match to d3wmmh2
    complexed with bcl, bph, ca, cdl, crt, fe, gol, hem, lda, lhg, lmt, mg, mq8, pef, pgv, so4, unl, uq8

Details for d5y5sh2

PDB Entry: 5y5s (more details), 1.9 Å

PDB Description: structure of photosynthetic lh1-rc super-complex at 1.9 angstrom resolution
PDB Compounds: (H:) Photosynthetic reaction center H subunit

SCOPe Domain Sequences for d5y5sh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y5sh2 b.41.1.1 (H:44-259) automated matches {Thermochromatium tepidum [TaxId: 1050]}
drtersggrvkvvgfpdlpdpktfvlphnggtvvaprveapvavnatpfspapgsplvpn
gdpmlsgfgpaaspdrpkhcdltfeglpkivpmrvakefsiaegdpdprgmtvvgldgev
agtvsdvwvdrsepqirylevevaankkkvllpigfsrfdkkarkvkvdaikaahfanvp
tlsnpdqvtlyeedkvcayyaggklyataeragpll

SCOPe Domain Coordinates for d5y5sh2:

Click to download the PDB-style file with coordinates for d5y5sh2.
(The format of our PDB-style files is described here.)

Timeline for d5y5sh2: