Lineage for d5y5sh1 (5y5s H:5-43)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2630999Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families) (S)
  5. 2631129Family f.23.10.0: automated matches [227192] (1 protein)
    not a true family
  6. 2631130Protein automated matches [226917] (6 species)
    not a true protein
  7. 2631150Species Thermochromatium tepidum [TaxId:1050] [267910] (5 PDB entries)
  8. 2631151Domain d5y5sh1: 5y5s H:5-43 [351062]
    Other proteins in same PDB: d5y5s0_, d5y5s1_, d5y5s2_, d5y5s3_, d5y5s4_, d5y5s5_, d5y5s6_, d5y5s7_, d5y5s8_, d5y5s9_, d5y5sa_, d5y5sb_, d5y5sc_, d5y5sd_, d5y5se_, d5y5sf_, d5y5sg_, d5y5sh2, d5y5si_, d5y5sj_, d5y5sk_, d5y5sm_, d5y5sn_, d5y5so_, d5y5sp_, d5y5sq_, d5y5sr_, d5y5ss_, d5y5st_, d5y5su_, d5y5sv_, d5y5sw_, d5y5sx_, d5y5sy_, d5y5sz_
    automated match to d3wmmh1
    complexed with bcl, bph, ca, cdl, crt, fe, gol, hem, lda, lhg, lmt, mg, mq8, pef, pgv, so4, unl, uq8

Details for d5y5sh1

PDB Entry: 5y5s (more details), 1.9 Å

PDB Description: structure of photosynthetic lh1-rc super-complex at 1.9 angstrom resolution
PDB Compounds: (H:) Photosynthetic reaction center H subunit

SCOPe Domain Sequences for d5y5sh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y5sh1 f.23.10.0 (H:5-43) automated matches {Thermochromatium tepidum [TaxId: 1050]}
ithyidaaqitiwafwlfffgliiylrredkregyplds

SCOPe Domain Coordinates for d5y5sh1:

Click to download the PDB-style file with coordinates for d5y5sh1.
(The format of our PDB-style files is described here.)

Timeline for d5y5sh1: