Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families) |
Family f.23.10.0: automated matches [227192] (1 protein) not a true family |
Protein automated matches [226917] (6 species) not a true protein |
Species Thermochromatium tepidum [TaxId:1050] [267910] (5 PDB entries) |
Domain d5y5sh1: 5y5s H:5-43 [351062] Other proteins in same PDB: d5y5s0_, d5y5s1_, d5y5s2_, d5y5s3_, d5y5s4_, d5y5s5_, d5y5s6_, d5y5s7_, d5y5s8_, d5y5s9_, d5y5sa_, d5y5sb_, d5y5sc_, d5y5sd_, d5y5se_, d5y5sf_, d5y5sg_, d5y5sh2, d5y5si_, d5y5sj_, d5y5sk_, d5y5sm_, d5y5sn_, d5y5so_, d5y5sp_, d5y5sq_, d5y5sr_, d5y5ss_, d5y5st_, d5y5su_, d5y5sv_, d5y5sw_, d5y5sx_, d5y5sy_, d5y5sz_ automated match to d3wmmh1 complexed with bcl, bph, ca, cdl, crt, fe, gol, hec, lda, lhg, lmt, mg, mq8, pef, pgv, so4, unl, uq8 |
PDB Entry: 5y5s (more details), 1.9 Å
SCOPe Domain Sequences for d5y5sh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5y5sh1 f.23.10.0 (H:5-43) automated matches {Thermochromatium tepidum [TaxId: 1050]} ithyidaaqitiwafwlfffgliiylrredkregyplds
Timeline for d5y5sh1:
View in 3D Domains from other chains: (mouse over for more information) d5y5s0_, d5y5s1_, d5y5s2_, d5y5s3_, d5y5s4_, d5y5s5_, d5y5s6_, d5y5s7_, d5y5s8_, d5y5s9_, d5y5sa_, d5y5sb_, d5y5sc_, d5y5sd_, d5y5se_, d5y5sf_, d5y5sg_, d5y5si_, d5y5sj_, d5y5sk_, d5y5sm_, d5y5sn_, d5y5so_, d5y5sp_, d5y5sq_, d5y5sr_, d5y5ss_, d5y5st_, d5y5su_, d5y5sv_, d5y5sw_, d5y5sx_, d5y5sy_, d5y5sz_ |