Lineage for d5ysya_ (5ysy A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335122Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2335123Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2335124Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2336099Protein Vitamin D nuclear receptor [48528] (2 species)
  7. 2336100Species Human (Homo sapiens) [TaxId:9606] [48529] (30 PDB entries)
  8. 3050996Domain d5ysya_: 5ysy A: [351058]
    automated match to d1ie9a_
    complexed with 90l

Details for d5ysya_

PDB Entry: 5ysy (more details), 2 Å

PDB Description: crystal structure of the human vitamin d receptor ligand binding domain complexed with (1r,2r,3r)-5-[(e)-2-{(1r,3as,7ar)-1-[(r)-6- hydroxy-6-methylheptan-2-yl]-7a-methyl-2,3,3a,6,7,7a-hexahydro-1h- inden-4-yl}vinyl]-2-(3-hydroxypropyl)cyclohex-4-ene-1,3-diol
PDB Compounds: (A:) Vitamin D3 receptor

SCOPe Domain Sequences for d5ysya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ysya_ a.123.1.1 (A:) Vitamin D nuclear receptor {Human (Homo sapiens) [TaxId: 9606]}
dslrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsqlsmlp
hladlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtc
gnqdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqd
aalieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrclsfqp
ecsmkltplvlevfg

SCOPe Domain Coordinates for d5ysya_:

Click to download the PDB-style file with coordinates for d5ysya_.
(The format of our PDB-style files is described here.)

Timeline for d5ysya_:

  • d5ysya_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-12