Lineage for d5vjob2 (5vjo B:108-211)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. Protein automated matches [190374] (15 species)
    not a true protein
  7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (649 PDB entries)
  8. Domain d5vjob2: 5vjo B:108-211 [351051]
    Other proteins in same PDB: d5vjoa_, d5vjob1, d5vjoc_, d5vjod1, d5vjoe_, d5vjof_
    automated match to d4m43l2
    complexed with cl, na; mutant

Details for d5vjob2

PDB Entry: 5vjo (more details), 2.4299999999999997 Å

PDB Description: complex between hyhel10 fab fragment heavy chain mutant i29f and pekin duck egg lysozyme isoform i (del-i)
PDB Compounds: (B:) HyHEL10 light chain Fab fragment

SCOPe Domain Sequences for d5vjob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vjob2 b.1.1.2 (B:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOPe Domain Coordinates for d5vjob2 are not available.

Timeline for d5vjob2:

Domains from same chain:
(mouse over for more information)
d5vjob1
Domains from other chains:
(mouse over for more information)
d5vjoa_, d5vjoc_, d5vjod1, d5vjod2, d5vjoe_, d5vjof_