| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (15 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
| Domain d5vjob2: 5vjo B:108-211 [351051] Other proteins in same PDB: d5vjoa_, d5vjob1, d5vjoc_, d5vjod1, d5vjoe_, d5vjof_ automated match to d4m43l2 complexed with cl, na; mutant |
PDB Entry: 5vjo (more details), 2.43 Å
SCOPe Domain Sequences for d5vjob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vjob2 b.1.1.2 (B:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr
Timeline for d5vjob2: