SCOPe 2.08: Domain d5vjob2: 5vjo B:108-211

Lineage for d5vjob2 (5vjo B:108-211)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d5vjob2: 5vjo B:108-211 [351051]
   Other proteins in same PDB: d5vjoa_, d5vjob1, d5vjoc_, d5vjod1, d5vjoe_, d5vjof_
   automated match to d4m43l2
   complexed with cl, na; mutant

Details for d5vjob2

PDB Entry: 5vjo, 2.43 Å

PDB Description: complex between hyhel10 fab fragment heavy chain mutant i29f and pekin duck egg lysozyme isoform i (del-i)

PDB Compounds: (B:) HyHEL10 light chain Fab fragment

SCOPe Domain Sequences for d5vjob2:

Sequence; same for both SEQRES and ATOM records:

>d5vjob2 b.1.1.2 (B:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d5vjob2:

• d5vjob2 first appeared in SCOPe 2.07