Lineage for d5vjob1 (5vjo B:1-107)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (29 species)
    not a true protein
  7. 2357727Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)
  8. 3050988Domain d5vjob1: 5vjo B:1-107 [351050]
    Other proteins in same PDB: d5vjob2, d5vjoe_, d5vjof_
    automated match to d4m43l1
    complexed with cl, na; mutant

Details for d5vjob1

PDB Entry: 5vjo (more details), 2.43 Å

PDB Description: complex between hyhel10 fab fragment heavy chain mutant i29f and pekin duck egg lysozyme isoform i (del-i)
PDB Compounds: (B:) HyHEL10 light chain Fab fragment

SCOPe Domain Sequences for d5vjob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vjob1 b.1.1.0 (B:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspatlsvtpgnsvslscrasqsignnlhwyqqkshesprllikyasqsisgips
rfsgsgsgtdftlsinsvetedfgmyfcqqsnswpytfgggtkleik

SCOPe Domain Coordinates for d5vjob1:

Click to download the PDB-style file with coordinates for d5vjob1.
(The format of our PDB-style files is described here.)

Timeline for d5vjob1:

  • d5vjob1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d5vjob2