SCOP 1.57: Domain d1f1ba2: 1f1b A:151-310

Lineage for d1f1ba2 (1f1b A:151-310)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (2 proteins)

6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (2 species)

7. Species Escherichia coli [TaxId:562] [53674] (28 PDB entries)

8. Domain d1f1ba2: 1f1b A:151-310 [35105]
   Other proteins in same PDB: d1f1bb1, d1f1bb2, d1f1bd1, d1f1bd2

Details for d1f1ba2

PDB Entry: 1f1b, 2.3 Å

PDB Description: crystal structure of e. coli aspartate transcarbamoylase p268a mutant in the r-state in the presence of n-phosphonacetyl-l-aspartate

SCOP Domain Sequences for d1f1ba2:

Sequence; same for both SEQRES and ATOM records:

>d1f1ba2 c.78.1.1 (A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli}
rldnlhvamvgdlkygrtvhsltqalakfdgnrfyfiapdalampqyildmldekgiaws
lhssieevmaevdilymtrvqkerldpseyanvkaqfvlrasdlhnakanmkvlhplarv
deiatdvdktphawyfqqagngifarqallalvlnrdlvl

Timeline for d1f1ba2:

• d1f1ba2 first appeared (with stable ids) in SCOP 1.55
  
• d1f1ba2 appears in SCOP 1.59
  
• d1f1ba2 appears in the current release, SCOPe 2.08