Lineage for d5vjqi_ (5vjq I:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2531350Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2531351Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2531389Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 2532723Protein automated matches [190299] (8 species)
    not a true protein
  7. 2532775Species Duck (Anas platyrhynchos) [TaxId:8839] [341650] (7 PDB entries)
  8. 2532785Domain d5vjqi_: 5vjq I: [351049]
    Other proteins in same PDB: d5vjqb1, d5vjqb2, d5vjqd1, d5vjqd2, d5vjqf1, d5vjqf2, d5vjqh1, d5vjqh2
    automated match to d5v92a_
    complexed with cl, gol; mutant

Details for d5vjqi_

PDB Entry: 5vjq (more details), 1.9 Å

PDB Description: complex between hyhel10 fab fragment heavy chain mutant (i29f, s52t, y53f) and pekin duck egg lysozyme isoform i (del-i)
PDB Compounds: (I:) lysozyme

SCOPe Domain Sequences for d5vjqi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vjqi_ d.2.1.2 (I:) automated matches {Duck (Anas platyrhynchos) [TaxId: 8839]}
kvysrcelaaamkrlgldnyrgyslgnwvcaanyessfntqatnrntdgstdygilqins
rwwcddgktpgsknacgipcsvllrsditeavrcakrivsdgngmnawvawrnrcrgtdv
skwirgcrl

SCOPe Domain Coordinates for d5vjqi_:

Click to download the PDB-style file with coordinates for d5vjqi_.
(The format of our PDB-style files is described here.)

Timeline for d5vjqi_: