SCOP 1.67: Domain d1f1ba1: 1f1b A:1-150

Lineage for d1f1ba1 (1f1b A:1-150)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins)

6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (3 species)

7. Species Escherichia coli [TaxId:562] [53674] (30 PDB entries)

8. Domain d1f1ba1: 1f1b A:1-150 [35104]
   Other proteins in same PDB: d1f1bb1, d1f1bb2, d1f1bd1, d1f1bd2

Details for d1f1ba1

PDB Entry: 1f1b, 2.3 Å

PDB Description: crystal structure of e. coli aspartate transcarbamoylase p268a mutant in the r-state in the presence of n-phosphonacetyl-l-aspartate

SCOP Domain Sequences for d1f1ba1:

Sequence; same for both SEQRES and ATOM records:

>d1f1ba1 c.78.1.1 (A:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqg

Timeline for d1f1ba1:

• d1f1ba1 first appeared (with stable ids) in SCOP 1.55
  
• d1f1ba1 appears in SCOP 1.65
  
• d1f1ba1 appears in SCOP 1.69
  
• d1f1ba1 appears in the current release, SCOPe 2.08