Lineage for d5yufb_ (5yuf B:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2588606Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 2588607Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 2588608Family g.44.1.1: RING finger domain, C3HC4 [57851] (15 proteins)
  6. 2588664Protein automated matches [254608] (2 species)
    not a true protein
  7. 2588667Species Human (Homo sapiens) [TaxId:9606] [255493] (2 PDB entries)
  8. 3050974Domain d5yufb_: 5yuf B: [351036]
    automated match to d2mwxa_
    complexed with zn

Details for d5yufb_

PDB Entry: 5yuf (more details), 1.6 Å

PDB Description: crystal structure of pml ring tetramer
PDB Compounds: (B:) Protein PML

SCOPe Domain Sequences for d5yufb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yufb_ g.44.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
efqflrcqqcqaeakcpkllpclhtlcsgcleasgmqcpicqapwpl

SCOPe Domain Coordinates for d5yufb_:

Click to download the PDB-style file with coordinates for d5yufb_.
(The format of our PDB-style files is described here.)

Timeline for d5yufb_:

  • d5yufb_ is new in SCOPe 2.07-stable