Lineage for d5ylje_ (5ylj E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2339505Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2339704Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2339705Family a.137.10.1: Stathmin [101495] (2 proteins)
  6. 2339706Protein Stathmin 4 [101496] (2 species)
  7. 2339707Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (97 PDB entries)
  8. 3050973Domain d5ylje_: 5ylj E: [351035]
    Other proteins in same PDB: d5ylja1, d5ylja2, d5yljb1, d5yljb2, d5yljc1, d5yljc2, d5yljd1, d5yljd2, d5yljf1, d5yljf2, d5yljf3
    automated match to d4i55e_
    complexed with 8x0, acp, ca, gdp, gol, gtp, mes, mg

Details for d5ylje_

PDB Entry: 5ylj (more details), 2.7 Å

PDB Description: crystal structure of t2r-ttl-millepachine complex
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d5ylje_:

Sequence, based on SEQRES records: (download)

>d5ylje_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelke

Sequence, based on observed residues (ATOM records): (download)

>d5ylje_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
e

SCOPe Domain Coordinates for d5ylje_:

Click to download the PDB-style file with coordinates for d5ylje_.
(The format of our PDB-style files is described here.)

Timeline for d5ylje_:

  • d5ylje_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-12