SCOPe 2.08: Domain d5vjqh2: 5vjq H:108-212

Lineage for d5vjqh2 (5vjq H:108-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d5vjqh2: 5vjq H:108-212 [351015]
   Other proteins in same PDB: d5vjqa_, d5vjqb1, d5vjqc_, d5vjqd1, d5vjqe_, d5vjqf1, d5vjqg_, d5vjqh1, d5vjqi_, d5vjqj_, d5vjqk_, d5vjql_
   automated match to d2fd6l2
   complexed with cl, gol; mutant

Details for d5vjqh2

PDB Entry: 5vjq, 1.9 Å

PDB Description: complex between hyhel10 fab fragment heavy chain mutant (i29f, s52t, y53f) and pekin duck egg lysozyme isoform i (del-i)

PDB Compounds: (H:) HyHEL10 light chain Fab fragment

SCOPe Domain Sequences for d5vjqh2:

Sequence; same for both SEQRES and ATOM records:

>d5vjqh2 b.1.1.2 (H:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d5vjqh2:

• d5vjqh2 first appeared in SCOPe 2.07