![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
![]() | Domain d5vjqh1: 5vjq H:1-107 [351014] Other proteins in same PDB: d5vjqa_, d5vjqb2, d5vjqc_, d5vjqd2, d5vjqe_, d5vjqf2, d5vjqg_, d5vjqh2, d5vjqi_, d5vjqj_, d5vjqk_, d5vjql_ automated match to d2fd6l1 complexed with cl, gol; mutant |
PDB Entry: 5vjq (more details), 1.9 Å
SCOPe Domain Sequences for d5vjqh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vjqh1 b.1.1.0 (H:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]} divltqspatlsvtpgnsvslscrasqsignnlhwyqqkshesprllikyasqsisgips rfsgsgsgtdftlsinsvetedfgmyfcqqsnswpytfgggtkleik
Timeline for d5vjqh1: