Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) |
Family c.79.1.0: automated matches [191338] (1 protein) not a true family |
Protein automated matches [190215] (38 species) not a true protein |
Species Fusobacterium nucleatum [TaxId:190304] [333378] (7 PDB entries) |
Domain d5xeob_: 5xeo B: [351010] Other proteins in same PDB: d5xeoa2 automated match to d4aeca_ complexed with act, ca, peg, plp |
PDB Entry: 5xeo (more details), 2.03 Å
SCOPe Domain Sequences for d5xeob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xeob_ c.79.1.0 (B:) automated matches {Fusobacterium nucleatum [TaxId: 190304]} lansvidligntplvkinnidtfgneiyvklegsnpgrstkdrialkmieeaekeglidk dtviieatsgntgiglamicavknyklkivmpdtmsieriqlmraygteviltdgslgmk aclekleelkknekkyfvpnqftnvnnpkahyettaeeilkdlnnkvdvficgtgtggsf sgtakklkeklpniktfpvepasspllskgyigphkiqgmgmsiggipavydgsladdil vcedddafemmrelsfkegilggistgatfkaaldyskenadkglkivvlstdsgekyl
Timeline for d5xeob_: