SCOPe 2.07: Domain d5y5sq_: 5y5s Q:

Lineage for d5y5sq_ (5y5s Q:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily)
   membrane all-alpha fold

4. Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families)

5. Family f.3.1.0: automated matches [254203] (1 protein)
   not a true family

6. Protein automated matches [254444] (7 species)
   not a true protein

7. Species Thermochromatium tepidum [TaxId:1050] [267909] (5 PDB entries)

8. Domain d5y5sq_: 5y5s Q: [351002]
   Other proteins in same PDB: d5y5sc_, d5y5sh1, d5y5sh2, d5y5sm_
   automated match to d3wmm1_
   complexed with bcl, bph, ca, cdl, crt, fe, gol, hem, lda, lhg, lmt, mg, mq8, pef, pgv, so4, unl, uq8

Details for d5y5sq_

PDB Entry: 5y5s, 1.9 Å

PDB Description: structure of photosynthetic lh1-rc super-complex at 1.9 angstrom resolution

PDB Compounds: (Q:) LH1 alpha polypeptide

SCOPe Domain Sequences for d5y5sq_:

Sequence; same for both SEQRES and ATOM records:

>d5y5sq_ f.3.1.0 (Q:) automated matches {Thermochromatium tepidum [TaxId: 1050]}
tmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalg

Timeline for d5y5sq_:

• d5y5sq_ is new in SCOPe 2.07-stable
  
• d5y5sq_ appears in the current release, SCOPe 2.08