Lineage for d5ucpb_ (5ucp B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. Protein automated matches [190115] (94 species)
    not a true protein
  7. Species Helicobacter pylori [TaxId:85962] [312431] (15 PDB entries)
  8. Domain d5ucpb_: 5ucp B: [351000]
    automated match to d3c4ua_
    complexed with 13p, g3h, na, p6f, zn

Details for d5ucpb_

PDB Entry: 5ucp (more details), 1.44 Å

PDB Description: class ii fructose-1,6-bisphosphate aldolase e142a variant of helicobacter pylori with fbp and cleavage products
PDB Compounds: (B:) Fructose-bisphosphate aldolase

SCOPe Domain Sequences for d5ucpb_:

Sequence, based on SEQRES records: (download)

>d5ucpb_ c.1.10.0 (B:) automated matches {Helicobacter pylori [TaxId: 85962]}
mlvkgneillkahkegygvgafnfvnfemlnaifeagneensplfiqasegaikymgidm
avgmvkimceryphipvalhldhgttfescekavkagftsvmidashhafeenleltskv
vkmahnagvsveaelgrlmgiadnisvdekdavlvnpkeaeqfvkesqvdylapaigtsh
gafkfkgepkldferlqevkrltniplvlhgasaipdnvrksyldaggdlkgskgvpfef
lqesvkgginkvntdtdlriafiaevrkvanedksqfdlrkffspaqlalknvvkermkl
lgsanki

Sequence, based on observed residues (ATOM records): (download)

>d5ucpb_ c.1.10.0 (B:) automated matches {Helicobacter pylori [TaxId: 85962]}
mlvkgneillkahkegygvgafnfvnfemlnaifeagneensplfiqasegaikymgidm
avgmvkimceryphipvalhldhgttfescekavkagftsvmidashhafeenleltskv
vkmahnagvsveaelgravlvnpkeaeqfvkesqvdylapaigtshgafkfkgepkldfe
rlqevkrltniplvlhgasaipdnvrksyldaggdlkgskgvpfeflqesvkgginkvnt
dtdlriafiaevrkvanedksqfdlrkffspaqlalknvvkermkllgsanki

SCOPe Domain Coordinates for d5ucpb_ are not available.

Timeline for d5ucpb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5ucpa_