Lineage for d1d09a1 (1d09 A:1-150)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 402003Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 402004Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family) (S)
  5. 402005Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins)
  6. 402006Protein Aspartate carbamoyltransferase catalytic subunit [53673] (3 species)
  7. 402017Species Escherichia coli [TaxId:562] [53674] (30 PDB entries)
  8. 402120Domain d1d09a1: 1d09 A:1-150 [35100]
    Other proteins in same PDB: d1d09b1, d1d09b2, d1d09d1, d1d09d2

Details for d1d09a1

PDB Entry: 1d09 (more details), 2.1 Å

PDB Description: aspartate transcarbamoylase complexed with n-phosphonacetyl-l-aspartate (pala)

SCOP Domain Sequences for d1d09a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d09a1 c.78.1.1 (A:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqqtqg

SCOP Domain Coordinates for d1d09a1:

Click to download the PDB-style file with coordinates for d1d09a1.
(The format of our PDB-style files is described here.)

Timeline for d1d09a1: