![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.17: YccV-like [141255] (1 family) ![]() contains extra C-terminal helix packed against barrel automatically mapped to Pfam PF08755 |
![]() | Family b.34.17.1: YccV-like [141256] (1 protein) |
![]() | Protein Hypothetical protein YccV [141257] (1 species) |
![]() | Species Escherichia coli [TaxId:585055] [350998] (1 PDB entry) |
![]() | Domain d5ycqa_: 5ycq A: [350999] automated match to d1vbva1 |
PDB Entry: 5ycq (more details), 2.5 Å
SCOPe Domain Sequences for d5ycqa_:
Sequence, based on SEQRES records: (download)
>d5ycqa_ b.34.17.1 (A:) Hypothetical protein YccV {Escherichia coli [TaxId: 585055]} askfgigqqvrhsllgylgvvvdidpvyslsepspdelavndelraapwyhvvmeddngl pvhtylaeaqlsselqdehpeqpsmdelaqtirkq
>d5ycqa_ b.34.17.1 (A:) Hypothetical protein YccV {Escherichia coli [TaxId: 585055]} askfgigqqvrhsllgylgvvvdidpvaapwyhvvmeddnglpvhtylaeaqlsselqde hpeqpsmdelaqtirkq
Timeline for d5ycqa_: