Lineage for d5ycqa_ (5ycq A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2785318Superfamily b.34.17: YccV-like [141255] (1 family) (S)
    contains extra C-terminal helix packed against barrel
    automatically mapped to Pfam PF08755
  5. 2785319Family b.34.17.1: YccV-like [141256] (1 protein)
  6. 2785320Protein Hypothetical protein YccV [141257] (1 species)
  7. 2785321Species Escherichia coli [TaxId:585055] [350998] (1 PDB entry)
  8. 2785322Domain d5ycqa_: 5ycq A: [350999]
    automated match to d1vbva1

Details for d5ycqa_

PDB Entry: 5ycq (more details), 2.5 Å

PDB Description: unique specificity-enhancing factor for the aaa+ lon protease
PDB Compounds: (A:) Heat shock protein HspQ

SCOPe Domain Sequences for d5ycqa_:

Sequence, based on SEQRES records: (download)

>d5ycqa_ b.34.17.1 (A:) Hypothetical protein YccV {Escherichia coli [TaxId: 585055]}
askfgigqqvrhsllgylgvvvdidpvyslsepspdelavndelraapwyhvvmeddngl
pvhtylaeaqlsselqdehpeqpsmdelaqtirkq

Sequence, based on observed residues (ATOM records): (download)

>d5ycqa_ b.34.17.1 (A:) Hypothetical protein YccV {Escherichia coli [TaxId: 585055]}
askfgigqqvrhsllgylgvvvdidpvaapwyhvvmeddnglpvhtylaeaqlsselqde
hpeqpsmdelaqtirkq

SCOPe Domain Coordinates for d5ycqa_:

Click to download the PDB-style file with coordinates for d5ycqa_.
(The format of our PDB-style files is described here.)

Timeline for d5ycqa_: