Lineage for d5ucna_ (5ucn A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2420459Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2421872Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2421873Protein automated matches [190115] (91 species)
    not a true protein
  7. 2422163Species Helicobacter pylori [TaxId:85962] [312431] (15 PDB entries)
  8. 3050932Domain d5ucna_: 5ucn A: [350994]
    automated match to d3c4ua_
    complexed with 13p, na, zn

Details for d5ucna_

PDB Entry: 5ucn (more details), 1.67 Å

PDB Description: class ii fructose-1,6-bisphosphate aldolase e142a variant of helicobacter pylori with dhap
PDB Compounds: (A:) Fructose-bisphosphate aldolase

SCOPe Domain Sequences for d5ucna_:

Sequence, based on SEQRES records: (download)

>d5ucna_ c.1.10.0 (A:) automated matches {Helicobacter pylori [TaxId: 85962]}
mlvkgneillkahkegygvgafnfvnfemlnaifeagneensplfiqasegaikymgidm
avgmvkimceryphipvalhldhgttfescekavkagftsvmidashhafeenleltskv
vkmahnagvsveaelgrlmgiadnisvdekdavlvnpkeaeqfvkesqvdylapaigtsh
gafkfkgepkldferlqevkrltniplvlhgasaipdnvrksyldaggdlkgskgvpfef
lqesvkgginkvntdtdlriafiaevrkvanedksqfdlrkffspaqlalknvvkermkl
lgsanki

Sequence, based on observed residues (ATOM records): (download)

>d5ucna_ c.1.10.0 (A:) automated matches {Helicobacter pylori [TaxId: 85962]}
mlvkgneillkahkegygvgafnfvnfemlnaifeagneensplfiqasegaikymgidm
avgmvkimceryphipvalhldhgttfescekavkagftsvmidashhafeenleltskv
vkmahnagvsveaelgrvlvnpkeaeqfvkesqvdylapaigtshgafkfkgepkldfer
lqevkrltniplvlhgasaipdnvrksyldaggdlkgskgvpfeflqesvkgginkvntd
tdlriafiaevrkvanedksqfdlrkffspaqlalknvvkermkllgsanki

SCOPe Domain Coordinates for d5ucna_:

Click to download the PDB-style file with coordinates for d5ucna_.
(The format of our PDB-style files is described here.)

Timeline for d5ucna_:

  • d5ucna_ is new in SCOPe 2.07-stable