Lineage for d6cx2a2 (6cx2 A:127-254)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species)
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [270905] (11 PDB entries)
  8. Domain d6cx2a2: 6cx2 A:127-254 [350990]
    automated match to d1plqa2
    mutant

Details for d6cx2a2

PDB Entry: 6cx2 (more details), 3.1 Å

PDB Description: s177g mutant of yeast pcna
PDB Compounds: (A:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d6cx2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cx2a2 d.131.1.2 (A:127-254) Proliferating cell nuclear antigen (PCNA) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
kieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigggsviikpfv
dmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfdlksgfl
qfflapkf

SCOPe Domain Coordinates for d6cx2a2 are not available.

Timeline for d6cx2a2:

Domains from same chain:
(mouse over for more information)
d6cx2a1