Lineage for d5xeoa1 (5xeo A:2-300)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. Protein automated matches [190215] (38 species)
    not a true protein
  7. Species Fusobacterium nucleatum [TaxId:190304] [333378] (6 PDB entries)
  8. Domain d5xeoa1: 5xeo A:2-300 [350982]
    Other proteins in same PDB: d5xeoa2
    automated match to d4aeca_
    complexed with act, ca, peg, plp

Details for d5xeoa1

PDB Entry: 5xeo (more details), 2.03 Å

PDB Description: crystal structure of a hydrogen sulfide-producing enzyme (fn1220) from fusobacterium nucleatum
PDB Compounds: (A:) Cysteine synthase

SCOPe Domain Sequences for d5xeoa1:

Sequence, based on SEQRES records: (download)

>d5xeoa1 c.79.1.0 (A:2-300) automated matches {Fusobacterium nucleatum [TaxId: 190304]}
lansvidligntplvkinnidtfgneiyvklegsnpgrstkdrialkmieeaekeglidk
dtviieatsgntgiglamicavknyklkivmpdtmsieriqlmraygteviltdgslgmk
aclekleelkknekkyfvpnqftnvnnpkahyettaeeilkdlnnkvdvficgtgtggsf
sgtakklkeklpniktfpvepasspllskgyigphkiqgmgmsiggipavydgsladdil
vcedddafemmrelsfkegilggistgatfkaaldyskenadkglkivvlstdsgekyl

Sequence, based on observed residues (ATOM records): (download)

>d5xeoa1 c.79.1.0 (A:2-300) automated matches {Fusobacterium nucleatum [TaxId: 190304]}
lansvidligntplvkinnidtfgneiyvklegsnpgrstkdrialkmieeaekeglidk
dtviieatsgntgiglamicavknyklkivmpdtmsieriqlmraygteviltdggmkac
lekleelkknekkyfvpnqftnvnnpkahyettaeeilkdlnnkvdvficgtgtggsfsg
takklkeklpniktfpvepasspllskgyigphkiqgmgmsiggipavydgsladdilvc
edddafemmrelsfkegilggistgatfkaaldyskenadkglkivvlstdsgekyl

SCOPe Domain Coordinates for d5xeoa1 are not available.

Timeline for d5xeoa1:

Domains from same chain:
(mouse over for more information)
d5xeoa2
Domains from other chains:
(mouse over for more information)
d5xeob_