Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (84 species) not a true protein |
Species Streptococcus pneumoniae [TaxId:171101] [226388] (3 PDB entries) |
Domain d5vfaa1: 5vfa A:2-125 [350971] Other proteins in same PDB: d5vfaa2, d5vfaa3, d5vfab2, d5vfab3 automated match to d1kgsa2 mutant |
PDB Entry: 5vfa (more details), 1.45 Å
SCOPe Domain Sequences for d5vfaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vfaa1 c.23.1.0 (A:2-125) automated matches {Streptococcus pneumoniae [TaxId: 171101]} gkrilllekernlahflslelqkeqyrvdlveegqkalsmalqtdydlillnvnlgdmma qdfaeklsrtkpasvimildhwedlqeelevvqrfavsyiykpvlienlvarisaifrgr dfid
Timeline for d5vfaa1: