Lineage for d5vfga_ (5vfg A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) (S)
    two constituent families are related by circular permutation
  5. Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
    topologically similar to the C-terminal domain of PapD
  6. Protein Synaptogamin I [49576] (3 species)
    duplication: contains tandem repeat of two similar domains
  7. Species Mouse (Mus musculus) [TaxId:10090] [335436] (5 PDB entries)
  8. Domain d5vfga_: 5vfg A: [350970]
    automated match to d5w5df_
    complexed with pb

Details for d5vfga_

PDB Entry: 5vfg (more details), 1.82 Å

PDB Description: synaptotagmin 1 c2b domain, lead-bound (high occupancy)
PDB Compounds: (A:) Synaptotagmin-1

SCOPe Domain Sequences for d5vfga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vfga_ b.7.1.2 (A:) Synaptogamin I {Mouse (Mus musculus) [TaxId: 10090]}
eklgdisfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkrlkkkktti
kkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgynstgaelrhw
sdmlanprrpiaqwhtlqveeevdamlavkk

SCOPe Domain Coordinates for d5vfga_ are not available.

Timeline for d5vfga_: