Lineage for d5vjof_ (5vjo F:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. Protein automated matches [190299] (8 species)
    not a true protein
  7. Species Duck (Anas platyrhynchos) [TaxId:8839] [341650] (7 PDB entries)
  8. Domain d5vjof_: 5vjo F: [350969]
    Other proteins in same PDB: d5vjoa_, d5vjob1, d5vjob2, d5vjoc_, d5vjod1, d5vjod2
    automated match to d5v92a_
    complexed with cl, na; mutant

Details for d5vjof_

PDB Entry: 5vjo (more details), 2.4299999999999997 Å

PDB Description: complex between hyhel10 fab fragment heavy chain mutant i29f and pekin duck egg lysozyme isoform i (del-i)
PDB Compounds: (F:) lysozyme isoform I (DEL-I)

SCOPe Domain Sequences for d5vjof_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vjof_ d.2.1.2 (F:) automated matches {Duck (Anas platyrhynchos) [TaxId: 8839]}
kvysrcelaaamkrlgldnyrgyslgnwvcaanyessfntqatnrntdgstdygilqins
rwwcddgktpgsknacgipcsvllrsditeavrcakrivsdgngmnawvawrnrcrgtdv
skwirgcrl

SCOPe Domain Coordinates for d5vjof_ are not available.

Timeline for d5vjof_:

Domains from other chains:
(mouse over for more information)
d5vjoa_, d5vjob1, d5vjob2, d5vjoc_, d5vjod1, d5vjod2, d5vjoe_