Lineage for d6ekid_ (6eki D:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. Protein automated matches [191011] (16 species)
    not a true protein
  7. Species Persephonella marina [TaxId:309805] [350833] (1 PDB entry)
  8. Domain d6ekid_: 6eki D: [350965]
    automated match to d4coqb_
    complexed with zn

Details for d6ekid_

PDB Entry: 6eki (more details), 2.56 Å

PDB Description: structure of a hyperthermostable carbonic anhydrase identified from an active hydrothermal vent chimney
PDB Compounds: (D:) carbonic anhydrase

SCOPe Domain Sequences for d6ekid_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ekid_ b.74.1.0 (D:) automated matches {Persephonella marina [TaxId: 309805]}
hwsyhgetgpqhwgdlkneyimckigknqspvdisriveaelekikinyssggssitnng
htikvsyepgsyiivdgirfelkqfhfhapsehtikgksypfeahfvhadkdgnlavigv
ifkegkknpiiekiwenlpeagktiklahkinaydllpkkkkyyrysgslttppcsegvr
wivmeeemelskeqiekfrklmggdtnrpvqplnarmimemd

SCOPe Domain Coordinates for d6ekid_ are not available.

Timeline for d6ekid_:

Domains from other chains:
(mouse over for more information)
d6ekia_, d6ekib_, d6ekic_, d6ekie_, d6ekif_