Lineage for d6et5u_ (6et5 u:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2627145Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily)
    membrane all-alpha fold
  4. 2627146Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families) (S)
  5. 2627209Family f.3.1.0: automated matches [254203] (1 protein)
    not a true family
  6. 2627210Protein automated matches [254444] (7 species)
    not a true protein
  7. 2627211Species Blastochloris viridis [TaxId:1079] [350827] (1 PDB entry)
  8. 2627224Domain d6et5u_: 6et5 u: [350960]
    Other proteins in same PDB: d6et5c_, d6et5h1, d6et5h2, d6et5m_
    automated match to d1wrga_
    complexed with bcb, bpb, fe, hem, lda, mq9, ns0, ns5, so4, uq9

Details for d6et5u_

PDB Entry: 6et5 (more details), 3 Å

PDB Description: reaction centre light harvesting complex 1 from blc. virids
PDB Compounds: (u:) Light-harvesting protein B-1015 beta chain

SCOPe Domain Sequences for d6et5u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6et5u_ f.3.1.0 (u:) automated matches {Blastochloris viridis [TaxId: 1079]}
adlkpsltglteeeakefhgifvtstvlylatavivhylvwtarpwiapipkgwv

SCOPe Domain Coordinates for d6et5u_:

Click to download the PDB-style file with coordinates for d6et5u_.
(The format of our PDB-style files is described here.)

Timeline for d6et5u_: