Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily) membrane all-alpha fold |
Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families) |
Family f.3.1.0: automated matches [254203] (1 protein) not a true family |
Protein automated matches [254444] (7 species) not a true protein |
Species Blastochloris viridis [TaxId:1079] [350827] (1 PDB entry) |
Domain d6et5u_: 6et5 u: [350960] Other proteins in same PDB: d6et5c_, d6et5h1, d6et5h2, d6et5m_ automated match to d1wrga_ complexed with bcb, bpb, fe, hem, lda, mq9, ns0, ns5, so4, uq9 |
PDB Entry: 6et5 (more details), 3 Å
SCOPe Domain Sequences for d6et5u_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6et5u_ f.3.1.0 (u:) automated matches {Blastochloris viridis [TaxId: 1079]} adlkpsltglteeeakefhgifvtstvlylatavivhylvwtarpwiapipkgwv
Timeline for d6et5u_: