Lineage for d5vfea_ (5vfe A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2382505Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2382506Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 2382667Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
    topologically similar to the C-terminal domain of PapD
  6. 2382693Protein Synaptogamin I [49576] (3 species)
    duplication: contains tandem repeat of two similar domains
  7. 2382714Species Mouse (Mus musculus) [TaxId:10090] [335436] (5 PDB entries)
  8. 2382715Domain d5vfea_: 5vfe A: [350954]
    automated match to d2k45a_
    complexed with pb, so4

Details for d5vfea_

PDB Entry: 5vfe (more details), 1.38 Å

PDB Description: synaptotagmin 1 c2a domain, lead-bound
PDB Compounds: (A:) Synaptotagmin-1

SCOPe Domain Sequences for d5vfea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vfea_ b.7.1.2 (A:) Synaptogamin I {Mouse (Mus musculus) [TaxId: 10090]}
klgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvkvfllpdkkkkfetkvhrk
tlnpvfneqftfkvpyselggktlvmavydfdrfskhdiigefkvpmntvdfghvteewr
dlqsa

SCOPe Domain Coordinates for d5vfea_:

Click to download the PDB-style file with coordinates for d5vfea_.
(The format of our PDB-style files is described here.)

Timeline for d5vfea_: