SCOPe 2.08: Domain d5vfeb_: 5vfe B:

Lineage for d5vfeb_ (5vfe B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families)
   two constituent families are related by circular permutation

5. Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
   topologically similar to the C-terminal domain of PapD

6. Protein Synaptogamin I [49576] (3 species)
   duplication: contains tandem repeat of two similar domains

7. Species Mouse (Mus musculus) [TaxId:10090] [335436] (5 PDB entries)

8. Domain d5vfeb_: 5vfe B: [350952]
   automated match to d2k45a_
   complexed with pb, so4

Details for d5vfeb_

PDB Entry: 5vfe, 1.38 Å

PDB Description: synaptotagmin 1 c2a domain, lead-bound

PDB Compounds: (B:) Synaptotagmin-1

SCOPe Domain Sequences for d5vfeb_:

Sequence; same for both SEQRES and ATOM records:

>d5vfeb_ b.7.1.2 (B:) Synaptogamin I {Mouse (Mus musculus) [TaxId: 10090]}
klgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvkvfllpdkkkkfetkvhrk
tlnpvfneqftfkvpyselggktlvmavydfdrfskhdiigefkvpmntvdfghvteewr
dlqs

Timeline for d5vfeb_:

• d5vfeb_ first appeared in SCOPe 2.07