![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
![]() | Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) ![]() two constituent families are related by circular permutation |
![]() | Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins) topologically similar to the C-terminal domain of PapD |
![]() | Protein Synaptogamin I [49576] (3 species) duplication: contains tandem repeat of two similar domains |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [335436] (5 PDB entries) |
![]() | Domain d5vfeb_: 5vfe B: [350952] automated match to d2k45a_ complexed with pb, so4 |
PDB Entry: 5vfe (more details), 1.38 Å
SCOPe Domain Sequences for d5vfeb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vfeb_ b.7.1.2 (B:) Synaptogamin I {Mouse (Mus musculus) [TaxId: 10090]} klgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvkvfllpdkkkkfetkvhrk tlnpvfneqftfkvpyselggktlvmavydfdrfskhdiigefkvpmntvdfghvteewr dlqs
Timeline for d5vfeb_: