Lineage for d5w0ha1 (5w0h A:258-336)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2518968Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2518969Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2519437Protein automated matches [190332] (5 species)
    not a true protein
  7. 2519440Species Human (Homo sapiens) [TaxId:9606] [187155] (30 PDB entries)
  8. 3050886Domain d5w0ha1: 5w0h A:258-336 [350948]
    Other proteins in same PDB: d5w0ha2
    automated match to d1d8za_
    protein/RNA complex

Details for d5w0ha1

PDB Entry: 5w0h (more details), 1.11 Å

PDB Description: structure of u2af65 (u2af2) rrm2 at 1.11 angstrom resolution
PDB Compounds: (A:) splicing factor u2af 65 kda subunit

SCOPe Domain Sequences for d5w0ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w0ha1 d.58.7.1 (A:258-336) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ahklfigglpnylnddqvkelltsfgplkafnlvkdsatglskgyafceyvdinvtdqai
aglngmqlgdkkllvqras

SCOPe Domain Coordinates for d5w0ha1:

Click to download the PDB-style file with coordinates for d5w0ha1.
(The format of our PDB-style files is described here.)

Timeline for d5w0ha1:

  • d5w0ha1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d5w0ha2